PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn076941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 383aa    MW: 41667.7 Da    PI: 4.733
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn076941genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-33247301155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr+rWtpeLHe+Fveav++LGGse+AtPk +l+l++v+gLt++hvkSHLQkYR+
  Achn076941 247 KPRMRWTPELHEAFVEAVNKLGGSERATPKGVLKLLNVEGLTIYHVKSHLQKYRT 301
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.312244304IPR017930Myb domain
SuperFamilySSF466898.42E-18245301IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-30246303IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-24247301IPR006447Myb domain, plants
PfamPF002492.6E-10249300IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MAVSGAMSSS SPVFHAPLGE KYPKLPDSFQ VLSESELMTH PISTQLTPLA SKSGTTGHLF  60
SSGSGFPTDV RLSSVSPQAR GPNNASFISQ TSSDGVSLLP IHSSHSGVQS IPLINYPKED  120
NDMSWTTDSL QDFLDFPDNV LIHNGPIEST IGVATEDHAK RNDWQDWANQ LINVDDALDS  180
NWSDLLVDVN VPDPKPKIVI LLWTAYQVIE PSTDISSHQP QVHLQHSVPS GEICLVASPL  240
SSAAPTKPRM RWTPELHEAF VEAVNKLGGS ERATPKGVLK LLNVEGLTIY HVKSHLQKYR  300
TARYKPESSE GTSEKKSTPI EEITSLDLKT DFPGSFPLVI DVNVSMEDLP IADSGVVWNP  360
AFDEMWLQLE NPIHGGFLGF TS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270511.11e-125PREDICTED: protein PHR1-LIKE 1
TrEMBLF6HZP91e-125F6HZP9_VITVI; Putative uncharacterized protein
STRINGVIT_07s0005g04120.t011e-124(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.21e-65G2-like family protein